PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g090220.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 259aa    MW: 27377.6 Da    PI: 8.0339
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g090220.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-382079362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++P+Ggg+rkn k+s
  Sopim02g090220.0.1 20 PEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPIGGGSRKNAKRS 79
                        57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-291677IPR003851Zinc finger, Dof-type
PfamPF027013.0E-332277IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1612377IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102561IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MPSDVRATKQ QQGGAPAPEP EHLPCPRCDS TNTKFCYYNN YNFSQPRHFC KSCRRYWTHG  60
GTLRDIPIGG GSRKNAKRSR TITTNSMNSS CLSSTLSPRD YHHAPHPSHV SPFLVPLTAD  120
HGGSLPFDVK PSVNMCGSFT SLLSSAQGPG GLLALGGFGL GVEDMGFGLG RPIWPFPGVS  180
HNTSVDNNSN GAGASMYGST WQLASGGEGG FVGAGGEIFN FPDLAISTHG NVFNCTFLAS  240
GVLALEFRTA VPSIDHQL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154280.0AC215428.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0226F10, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232067.11e-171PREDICTED: dof zinc finger protein DOF3.4
SwissprotQ390883e-51DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLK4BCH30.0K4BCH3_SOLLC; Uncharacterized protein
STRINGSolyc02g090220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.14e-47OBF binding protein 1